SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78063384|ref|YP_373292.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78063384|ref|YP_373292.1|
Domain Number 1 Region: 42-443
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.05e-27
Family C-terminal domain of adrenodoxin reductase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78063384|ref|YP_373292.1|
Sequence length 477
Comment FAD dependent oxidoreductase [Burkholderia lata]
Sequence
MTTPHDALHALEARLAQDLRWLDLPAPSWVPPREADGTRVLDVAIVGGGMAGLAASAELR
LLGIDNQCVIDRAPAGYEGPWVTFARMDTLRSPKQLAGPALGLPALTFRAWFEAQYGRDA
WDALYKIPRAQWMDYLRWYRRVLDLQVRNDTTLVALRPRDDGLLALDVRGNGEAQTLLAR
HVVLATGRDGLGGPYVPPVAQRAPRTRWAHSSEPIDFAALAGKRIGVVGAGASAFDNAGT
ALEAGAARVDLFFRRTDIPRINKLTGIGSPGLVHGYADLDDATKWRFMHYALTSQTPPPR
DSVLRVSRHEHAHFHAGSPIETLAEHAGGLDVTTPRGRYTVDFLIFATGFHSDWTTRAEF
ASFGAQVRRWKDRYRPEPGTWIDELAESPDLGPAFAFQERAPGTCAAITRIHCFNHAASL
SHGKLSGDIPAISAGAKRLARGIASRLFDADRDRHYDALVAYANAELQGDEWRDADA
Download sequence
Identical sequences Q392G8
gi|78063384|ref|YP_373292.1| WP_011356130.1.41686 269483.Bcep18194_B2537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]