SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78064895|ref|YP_367664.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78064895|ref|YP_367664.1|
Domain Number 1 Region: 747-997
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.2e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 2 Region: 33-215
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.06e-18
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.078
Further Details:      
 
Domain Number 3 Region: 461-649
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.57e-17
Family Pyruvate oxidase and decarboxylase PP module 0.034
Further Details:      
 
Weak hits

Sequence:  gi|78064895|ref|YP_367664.1|
Domain Number - Region: 280-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000241
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.048
Further Details:      
 
Domain Number - Region: 645-705
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0227
Family Ferredoxin domains from multidomain proteins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78064895|ref|YP_367664.1|
Sequence length 1196
Comment indolepyruvate ferredoxin oxidoreductase [Burkholderia lata]
Sequence
MNAPLDAGQRASLEAALKSVTLDDKYTLERGRAYMSGIQALVRLPMLQQERDRAAGLNTA
GFISGYRGSPLGGLDLSLWKAKQHLAAHQIVFQPGLNEDLAATAVWGSQQVNLYPGAKHD
GVFGMWYGKGPGVDRTGDVFKHANSAGSSQHGGVLVLAGDDHAAKSSTLAHQSEHIFKAC
GLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVESSASVDIDPHRTEIVLPTD
FILPEGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLDRIEIDSPNARFGIMTGGKA
YLDVRQALTDLGLDDETCARIGIRLYKVGCVWPLEAQGAQAFARGLDEILVVEEKRQILE
YAIKEELYNWPDGQRPRVFGKFDEKDGAGGEWSVPMGNWLLPAHYELSPAIIAKAIATRL
EKFELPSDVRASIAARLAVINAKEMALAKPHVQTERKPWFCSGCPHNTSTNVPEGSRAIA
GIGCHYMTVWMDRSTSTFSQMGGEGVPWIGQAPFTDEKHVFANLGDGTYFHSGLLAVRAA
ISSKANITYKILYNDAVAMTGGQPVDGVLTVPQITHQLASEGAKKIVIVTDEPEKYDSQK
ALLAPGVTIHHRDQLDDVQRELREIEGTTILIYDQTCATEKRRRRKRGTYPDPAKRVVIN
DAVCEGCGDCSVQSNCLSVEPLETEFGTKRQINQSSCNKDFSCVKGFCPSFVTVEGGQLK
KPKAVSVDGNALPPIPEPTLPDIDRAYGVLVTGVGGTGVVTIGALLGMAAHLENKGVTVL
DVTGLAQKGGAVMSHVQISHAPTDIHATRIAMGEADLVIGCDALVTAGDECTSRMRHDTT
RVVVNSAQTPTAEFIKNPNWAFPGLSAENDIRAAAGEAVDFIDANHFAVALLGDAIYTNP
FVLGYAWQKGWLPLTLASLVRAIELNAVSVEKNRAAFDWGRRAAYDLASVKQAAAGDARP
AQGATVIALHTKKAVDALIAKRVEFLTAYQNAAYASRYAAFVDKVRAAERTLADGDTMQE
QLTEAVARNLFKLMAYKDEYEVARLQSDPAFLARLTAQFEGDWKLKFHLAPPLFAKTDAH
GHLVKKAYGPWMMSAFRMLAKAKFLRGTGLDPFGRTEERRTERALIGEYEALIGEVLAKL
NAANRPLALELAALPDGIRGYGHVKENNLRAVRVKWDTLLAKWRAPAGGQSHQQVA
Download sequence
Identical sequences Q39KJ6
gi|78064895|ref|YP_367664.1| 269483.Bcep18194_A3418 WP_011350653.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]