SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78064921|ref|YP_367690.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78064921|ref|YP_367690.1|
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-105
Family G proteins 0.00000003
Further Details:      
 
Domain Number 2 Region: 484-605
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-42
Family Translational machinery components 0.00000785
Further Details:      
 
Domain Number 3 Region: 271-407
Classification Level Classification E-value
Superfamily Translation proteins 6.85e-35
Family Elongation factors 0.00011
Further Details:      
 
Domain Number 4 Region: 609-696
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.93e-29
Family EF-G/eEF-2 domains III and V 0.00016
Further Details:      
 
Domain Number 5 Region: 409-486
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.71e-26
Family EF-G/eEF-2 domains III and V 0.000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78064921|ref|YP_367690.1|
Sequence length 700
Comment elongation factor G [Burkholderia lata]
Sequence
MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERG
ITITSAATTAFWKGMGGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQ
PQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQLRLRLKANPVPVVVPIGAEEGFK
GVVDLIKMKAIIWDEASQGTKFDYVDIPAELVDTCNEWREKMVEAAAESNEDLMNKYLEA
GELSEAEIVKGLRDRTIACEIQPMLCGTAFKNKGVQRMLDAVIDFLPSPVDIPPVTGELE
NGEKTERRASDDEKFSALAFKIMTDPFVGQLIFFRVYSGVVNSGDTLLNATKDKKERLGR
ILQMHANQREEIKEVRAGDIAAAVGLKEATTGDTLCDPAHPIVLERMIFPEPVISQAVEP
KTKADQEKMGLALNRLAQEDPSFRVQTDEESGQTIISGMGELHLEILVDRMKREFGVEAT
VGKPQVAYRETIRKSAADVEGKFVKQSGGRGQYGHAVITLERSELGKGYEFVDAIKGGVI
PREYIPSVDKGIQETLKSGVLAGFPVVDVKVTLTFGSYHDVDSNENAFRMAGSMAFKEAM
RRADPVLLEPMMAVEVETPEDFMGNVMGDLSGRRGIIQGMDDMVGGGKIVRAEVPLSEMF
GYSTSLRSLTQGRATYTMEFKHYAEAPKNVAEAIISAKTK
Download sequence
Identical sequences A0A228J3J3 Q39KH0
WP_011350673.1.41686 WP_011350673.1.49553 WP_011350673.1.62993 gi|78064921|ref|YP_367690.1| 269483.Bcep18194_A3444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]