SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78065535|ref|YP_368304.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78065535|ref|YP_368304.1|
Domain Number 1 Region: 96-207
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.89e-31
Family Riboflavin synthase 0.00036
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.72e-16
Family Riboflavin synthase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78065535|ref|YP_368304.1|
Sequence length 211
Comment riboflavin synthase subunit alpha [Burkholderia lata]
Sequence
MFSGIVAAVGRIESIQPLGASADAGVRLTVLAGGLDLADVALGDSIAIQGACMTVIEKSD
AAFDVDVSRESLNRTVGLATPGDVNLEKALRAHDRLGGHIVSGHVDGLGTVSRFEPVGES
HELRIVAPRELGRYLAYKGSITVNGVSLTVNTIDDRADGCEFSINLIPHTVEVTTLRHVK
AGDKVNLKVDMIARYVERMMSAAKDSHMTSK
Download sequence
Identical sequences Q39IQ6
gi|78065535|ref|YP_368304.1| WP_011351241.1.41686 269483.Bcep18194_A4063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]