SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78065684|ref|YP_368453.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78065684|ref|YP_368453.1|
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.9e-26
Family 7-Fe ferredoxin 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78065684|ref|YP_368453.1|
Sequence length 107
Comment 4Fe-4S ferredoxin [Burkholderia lata]
Sequence
MTHVVTEGCIKCKYTDCVDVCPVDCFREGPNFLAIDPDECIDCAVCVAECPTNAIYAEED
VPGDQQQFTALNAELAKDWPSITKTKPAPADADEWKDVQDKLHLLER
Download sequence
Identical sequences A0A081VCG9 A0A084DDV2 A0A088TD09 A0A0B2BH02 A0A0D8E1L1 A0A0G3YRZ7 A0A0J6LWQ4 A0A104MZP2 A0A1I0KB63 A0A1X1PHU2 A0A228H2M2 A0A228J175 A0A228K773 A0A228PUK5 A0A228RCY0 Q39IA7 U2G3I9
WP_011351384.1.100089 WP_011351384.1.100092 WP_011351384.1.100350 WP_011351384.1.101796 WP_011351384.1.11350 WP_011351384.1.11802 WP_011351384.1.11846 WP_011351384.1.12 WP_011351384.1.12271 WP_011351384.1.12663 WP_011351384.1.13970 WP_011351384.1.15273 WP_011351384.1.15341 WP_011351384.1.15352 WP_011351384.1.15603 WP_011351384.1.1597 WP_011351384.1.19333 WP_011351384.1.19536 WP_011351384.1.2050 WP_011351384.1.21687 WP_011351384.1.21859 WP_011351384.1.23885 WP_011351384.1.26867 WP_011351384.1.27092 WP_011351384.1.28019 WP_011351384.1.28022 WP_011351384.1.2894 WP_011351384.1.29546 WP_011351384.1.30037 WP_011351384.1.30330 WP_011351384.1.30456 WP_011351384.1.30633 WP_011351384.1.33258 WP_011351384.1.35296 WP_011351384.1.35537 WP_011351384.1.36191 WP_011351384.1.36737 WP_011351384.1.38091 WP_011351384.1.39604 WP_011351384.1.4031 WP_011351384.1.40489 WP_011351384.1.41686 WP_011351384.1.45366 WP_011351384.1.45543 WP_011351384.1.46435 WP_011351384.1.46450 WP_011351384.1.47400 WP_011351384.1.47938 WP_011351384.1.4904 WP_011351384.1.49553 WP_011351384.1.50542 WP_011351384.1.52041 WP_011351384.1.52590 WP_011351384.1.55141 WP_011351384.1.55715 WP_011351384.1.5618 WP_011351384.1.58165 WP_011351384.1.58201 WP_011351384.1.58908 WP_011351384.1.59087 WP_011351384.1.59525 WP_011351384.1.60848 WP_011351384.1.60915 WP_011351384.1.6105 WP_011351384.1.61297 WP_011351384.1.61392 WP_011351384.1.62993 WP_011351384.1.63689 WP_011351384.1.65117 WP_011351384.1.65992 WP_011351384.1.66449 WP_011351384.1.66838 WP_011351384.1.66976 WP_011351384.1.67717 WP_011351384.1.67801 WP_011351384.1.67828 WP_011351384.1.69107 WP_011351384.1.69846 WP_011351384.1.70842 WP_011351384.1.71022 WP_011351384.1.7129 WP_011351384.1.72000 WP_011351384.1.73381 WP_011351384.1.73511 WP_011351384.1.74171 WP_011351384.1.76085 WP_011351384.1.76362 WP_011351384.1.76719 WP_011351384.1.77508 WP_011351384.1.78903 WP_011351384.1.79362 WP_011351384.1.79860 WP_011351384.1.82445 WP_011351384.1.82881 WP_011351384.1.84218 WP_011351384.1.84302 WP_011351384.1.84349 WP_011351384.1.84940 WP_011351384.1.85824 WP_011351384.1.86351 WP_011351384.1.87087 WP_011351384.1.8783 WP_011351384.1.89001 WP_011351384.1.90044 WP_011351384.1.90652 WP_011351384.1.91654 WP_011351384.1.91770 WP_011351384.1.94348 WP_011351384.1.94474 WP_011351384.1.95564 WP_011351384.1.96101 WP_011351384.1.96507 WP_011351384.1.97923 WP_011351384.1.98796 WP_011351384.1.99173 WP_011351384.1.99354 gi|78065684|ref|YP_368453.1| 269483.Bcep18194_A4212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]