SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78065716|ref|YP_368485.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78065716|ref|YP_368485.1|
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.36e-55
Family G proteins 0.00024
Further Details:      
 
Domain Number 2 Region: 165-288
Classification Level Classification E-value
Superfamily Translation proteins 1.43e-28
Family Elongation factors 0.0054
Further Details:      
 
Domain Number 3 Region: 399-493
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.21e-26
Family EF-G/eEF-2 domains III and V 0.009
Further Details:      
 
Domain Number 4 Region: 292-370
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-18
Family EF-G/eEF-2 domains III and V 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78065716|ref|YP_368485.1|
Sequence length 597
Comment GTP-binding protein LepA [Burkholderia lata]
Sequence
MDHIRNFSIIAHIDHGKSTLADRIIQVCGGLADREMEAQVLDSMDIERERGITIKAQTAA
LSYRARDGKVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI
ELGVEVVPVLNKIDLPAANPENAIEEIEDVIGIDATDATRCSAKTGLGVEDVLESLIAKV
PPPKGDPAAPLQALIIDSWFDNYVGVVMLVRIVNGTLRPKDKIKLMATGAQYPVEHIGVF
TPKSRNLETLSAGQVGFIIAGIKELTAAKVGDTVTHATKAAVEPLPGFKEVKPQVFAGLY
PVEANQYDALRESLEKLKLNDASLQYEPEVSQALGFGFRCGFLGLLHMEIVQERLEREFD
MDLITTAPTVVYEVMMSDGAIIKVENPAKMPEPPRIEEIREPIVTVNLYMPQDYVGSVIT
LCEQKRGSQINMQYHGRQVQLTYEIPMAEIVLDFFDRLKSVSRGYASMDYEFKEYRAADV
VKVDMLINGDKVDALSVIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQATIGAHIIARE
NIKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAILRVEDK
Download sequence
Identical sequences Q39I75
WP_011351412.1.41686 gi|78065716|ref|YP_368485.1| 269483.Bcep18194_A4244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]