SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78065948|ref|YP_368717.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78065948|ref|YP_368717.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.92e-108
Family FMN-linked oxidoreductases 0.00000000136
Further Details:      
 
Domain Number 2 Region: 335-521
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.82e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000548
Further Details:      
 
Domain Number 3 Region: 471-629
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.4e-18
Family C-terminal domain of adrenodoxin reductase-like 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78065948|ref|YP_368717.1|
Sequence length 674
Comment 2,4-dienoyl-CoA reductase [Burkholderia lata]
Sequence
MTSRYPHLTTPLELGFTSLRNRVLMGSMHVGLEEAPNGFERMAAFYAERARGEAGLIVTG
GFAPNERGRPAPGGAMLTTEAEAERHRVVTRAVHAEGGKIALQILHFGRYAYHPALAAPS
ALKAPINPFTPHALSSDEVDETIADFVRCAALAQHAGYDGVEIMGSEGYLINEFIAARTN
HRDDAWGGAYENRIRFPVEIVRRVRERVGTNFILIYRLSMLDLVEGGSTLDEVIRLAQAI
EAAGATIINTGIGWHEARIPTIATKVPRAAYAWVTRQLMGQVGIPLVATNRINTPEVAEQ
LLADGYCDMVSMARPFLADAEFVRKAREGRADEINTCIGCNQACLDHTFSGRITSCLVNP
RACHETELVIRPAQQRKRIAVVGAGPAGLGFAVTAAERGHAVTLYEAGAEIGGQFNIAKK
VPGKEEFNETLRYFRRQIELRGVTLHLNTRATAEMLVQGEFDEVVIATGIVPRTPPIDGV
GHAKTLGYLDVLRDDQAVGSRVAIVGAGGIGFDVAEYLVHRAGAEHVDAERFFTEWGVDP
SYANAGGLRHAQPEPAARQIHLLQRKASKVGDGLGKTTGWIHRTGLKARGVGMSSAVTYR
RIDDDGFHVTIDGVEQTLPVDNVVICAGQEPLRELAEQLEAAGRKVHVIGGAYEAAELDA
KRAIHQGTSLAATL
Download sequence
Identical sequences Q39HJ3
gi|78065948|ref|YP_368717.1| WP_011351643.1.41686 269483.Bcep18194_A4477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]