SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78066757|ref|YP_369526.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78066757|ref|YP_369526.1|
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000181
Family Ferredoxin domains from multidomain proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78066757|ref|YP_369526.1|
Sequence length 81
Comment 4Fe-4S ferredoxin [Burkholderia lata]
Sequence
MSHTSHDIFQRSSAPVTIDETLCIADKGCTVCVDVCPLDLLAIDVSKGKAYMQFDECWYC
MPCERDCPTGAVKVDIPYLLR
Download sequence
Identical sequences Q39F84
269483.Bcep18194_A5288 gi|78066757|ref|YP_369526.1| WP_011352420.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]