SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78067003|ref|YP_369772.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|78067003|ref|YP_369772.1|
Domain Number - Region: 79-98,150-196,230-237
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000268
Family Short-chain ferredoxins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78067003|ref|YP_369772.1|
Sequence length 465
Comment polyferredoxin-like protein [Burkholderia lata]
Sequence
MSVVAAAKQGWLAQAGQWMQRHGALIRGIQWAVVAVYAFLIIVPAVLPLPDDTAHLWSNL
TLIAQFTFWGIWWPFVLLSMVMLGRVWCGVLCPEGALTEFASKFGRGGPIPRWIRWGGWP
FVAFGLTTIYGQMVSVYQYPLAVLFVLGGSTVGAIVIGVLYGREKRVWCKYLCPVNGVFG
LLARLAPMRYKVDEDAWRRSYKNGEHGHRVIPINCAPLVPLRNMKGAADCHMCGRCSGHR
DAISLSLRSPSDEVVNLGAQQANPWDTALILYGLLGVAIGAFHWTVSPWFVQIKQWLAGW
LIDHDITWPLETNAPWFLLTHYPDRNDVFSWLDGGLVISYIVGTGLVYGTALLVLLAGAT
LMLGRFDRVRLHHLAQALIPIAGAGVFLGLSATTLSLLRAEHVPLGWATDVRIAILVGAN
AWSAWLAWKVTGRYAGWLRRLAAFAWFAAGLAVIDSAWWLMFWGF
Download sequence
Identical sequences Q39EI8
gi|78067003|ref|YP_369772.1| WP_011352662.1.41686 269483.Bcep18194_A5534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]