SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78059680|ref|YP_366255.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78059680|ref|YP_366255.1|
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.43e-22
Family ArsR-like transcriptional regulators 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78059680|ref|YP_366255.1|
Sequence length 111
Comment ArsR family transcriptional regulator [Burkholderia lata]
Sequence
METNRTIAALAALAHESRLAVFRALVQAGPEGLPAGQIATLLDVPPSSLSFHLKELAHAQ
LVTSRQEGRFVFYCANFATMNGLLAYLTENCCGGNPCSPVSACPTSGTRQS
Download sequence
Identical sequences Q39PK5
gi|78059680|ref|YP_366255.1| WP_011349255.1.41686 269483.Bcep18194_C6561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]