SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78059881|ref|YP_366456.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78059881|ref|YP_366456.1|
Domain Number 1 Region: 108-226
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.96e-28
Family Aromatic dioxygenase reductase-like 0.0025
Further Details:      
 
Domain Number 2 Region: 215-321
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.64e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0057
Further Details:      
 
Domain Number 3 Region: 6-102
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.02e-27
Family Ferredoxin reductase FAD-binding domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78059881|ref|YP_366456.1|
Sequence length 323
Comment ferredoxin-NADPH reductase [Burkholderia lata]
Sequence
MTSGVGGLTVRVAAKREEAVGICSFELVSTDGQPMPAFSAGSHIDVAVPGGPTRQYSLCN
APEEGHRYQISILRDPNSRGGSAGMHDRVQVGDALAISVPKNNFPLAHDATRSLLMAGGI
GVTPILCMAERLAAIGAPFEMHYCSRSRARTAFLDRISRATYARHVQFHFDDQPDTPAFD
IAARLARPESGTHLYVCGPTGFMDAVLGAARAAGWPEAQLHYEFFAAGERVAADSDRFEV
EVASSGQVVTVEEDESIVQALARVGIEIETSCEQGVCRTCETRVLAGEPDHRDVCLTPAE
RADNDRLMPCCSRSKSARLVLDL
Download sequence
Identical sequences Q39P04
WP_011349456.1.41686 269483.Bcep18194_C6765 gi|78059881|ref|YP_366456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]