SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78060812|ref|YP_367387.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78060812|ref|YP_367387.1|
Domain Number 1 Region: 104-235
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.36e-29
Family Aromatic dioxygenase reductase-like 0.00028
Further Details:      
 
Domain Number 2 Region: 218-325
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.17e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0042
Further Details:      
 
Domain Number 3 Region: 14-106
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.61e-24
Family Ferredoxin reductase FAD-binding domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78060812|ref|YP_367387.1|
Sequence length 326
Comment ferredoxin [Burkholderia lata]
Sequence
MTQHQSGALDRQVLIVRDVADEANGIRSYELATEDGADLPAYEPGAHVAVHLENGITRQY
SLYEAAGLRKTYRIAVLKDPASRGGSRFLHEQVSVGERVRISGPYNHFPMTAGATSSLLI
AGGIGITPILSMAARLFSEGQPFALHYCARREQDAAFVDLLRRGVPFAAHVHLHFDGGDP
GKGLDVRSLLSDVTEGRHLYCCGPGGLMNAVEAAASHWPAGTVHFERFAAETADAAENTA
FRIHLCKSGLDLDVPADKSVLQVLKHAGFDISTVCEQGVCGACLTDVVDGVPEHRDQILT
DEEKRANDVMAVCCSRSRSPRLVLDL
Download sequence
Identical sequences Q39LC3
gi|78060812|ref|YP_367387.1| 269483.Bcep18194_C7699 WP_011350385.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]