SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78060987|ref|YP_370895.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78060987|ref|YP_370895.1|
Domain Number 1 Region: 131-274
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 5.1e-31
Family Succinyl-CoA synthetase domains 0.00022
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.76e-28
Family CoA-binding domain 0.0039
Further Details:      
 
Domain Number 3 Region: 286-435
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 1.57e-22
Family Succinyl-CoA synthetase domains 0.0025
Further Details:      
 
Domain Number 4 Region: 623-771
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.89e-20
Family N-acetyl transferase, NAT 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78060987|ref|YP_370895.1|
Sequence length 785
Comment GCN5-related N-acetyltransferase [Burkholderia lata]
Sequence
MTVRHLDALFQPKSVAVVGASSRAGSIGAMVWSRVLDGAFEGPVWPVNPKYRDLHGHAVV
ADVDRLPAPPSVAVICTPPATWAGIVRKLGELGTRVAIIVGEARTDADRAALDRTLKAAK
PFVLRIVGPGSLGVLSPARHAHFGAPAYTARSGGVAWVSQSNALTNAVLGWADARGLGFS
HVVALGGESDVDAGDVLDYLASDPGTRAILLELDTVRAARKFMSAARAAARNKPVLALRT
GRADPGDALYTAAFQRAGMVRVDALDDLLDEIETLGVGRVTARGAATLVTSDAGVAKLAV
DAVAEVRDVLADWSPAATSAVSAALPHLASPGNPLTLGDDARPEHFAAAVKALAPFPQTG
TLFVVHSTSHSAPADAVAHTLIESRQYAHRGILACFFGAVDAATRDALHANGIPVHTTPQ
RLARAYARLVDYNLGRQLLMQTPEGTPPQPAECVASAQADARRMVEAGQHELTGEAALHW
LSRFGLQGEPAVEPAGKKVVDVTVDMYDDSNFGPVFRYAVPPADGVSAPFVVYGLPPLNT
VLARAVMERSPYARSTPIEPTLDALTALSQVVCDVREVVAMSVTLRVLPDRAHVIAPRIT
LAAGRSRLAIMPYPRHLEQTLEWRGETVTIRPIRPEDEAAHNELLGAMTPDDLRMRFFGA
VRSFDHSQVARMTQIDYDREMAFIVSFTDVSGRDHTLAVARAVADPDNETAEFAIAVRPD
QKGKGLGRLMMTRIIDYARSRGTAWMIGEALRENSAMISLAKACGFAVSTTEEPGVVGFR
MKLQP
Download sequence
Identical sequences Q39BB0
269483.Bcep18194_B0134 gi|78060987|ref|YP_370895.1| WP_011353749.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]