SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78061713|ref|YP_371621.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78061713|ref|YP_371621.1|
Domain Number 1 Region: 73-151
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.62e-32
Family CO dehydrogenase ISP C-domain like 0.00046
Further Details:      
 
Domain Number 2 Region: 2-78
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.01e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78061713|ref|YP_371621.1|
Sequence length 153
Comment (2Fe-2S)-binding protein [Burkholderia lata]
Sequence
MPTSFVLNGKNVTLDADPSMPVLWAIREHAGLTGTKFGCGMAQCGACTVHLEGQAVRSCV
LPLAGIAGKHITTIEGLQSKPAHAVQAAWVKLQVPQCGYCQSGQIMSATALLEQNPKPTD
ADIDAAMNGNLCRCATYARIRAAIHDAAATLGA
Download sequence
Identical sequences A0A071M9G1 A0A0U4CX63 A0A103KEW7 Q398Y4
WP_011354470.1.101546 WP_011354470.1.20297 WP_011354470.1.41686 WP_011354470.1.64495 WP_011354470.1.88080 WP_011354470.1.89250 269483.Bcep18194_B0863 gi|78061713|ref|YP_371621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]