SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78062453|ref|YP_372361.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78062453|ref|YP_372361.1|
Domain Number 1 Region: 83-150
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 4.71e-30
Family CO dehydrogenase ISP C-domain like 0.00047
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78062453|ref|YP_372361.1|
Sequence length 151
Comment (2Fe-2S)-binding protein [Burkholderia lata]
Sequence
MITLNINGETRSVDAPDDMPLLWVLRDVVGLTGTKFGCGIAQCGACTVHLDGVAARSCVL
PVAAVAGRKITTIEAVGATPAGHKVQQAWRELDVVQCGYCQSGQVMAATALIASNPNPSD
ADIDAAMAGNICRCGTYNRIRAAVKQAAKEV
Download sequence
Identical sequences Q395Z4
WP_011355206.1.41686 WP_011355206.1.60310 WP_011355206.1.99910 269483.Bcep18194_B1603 gi|78062453|ref|YP_372361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]