SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78063033|ref|YP_372941.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78063033|ref|YP_372941.1|
Domain Number 1 Region: 146-238
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000605
Family N-acetyl transferase, NAT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78063033|ref|YP_372941.1|
Sequence length 243
Comment GCN5-related N-acetyltransferase [Burkholderia lata]
Sequence
MPDANDWLDIDYRTLFRLHPDRRIERENDPECSPAPRFWLGRCADGSLAGVRADVPAPIA
DALVRLADSEPPLADRMQPAHLERYLALLASVPHWNIGLVYPLPHALRFDTAPCVALIDG
DSDAGRHLLHALSTQGMPEGLFSMGFRHVADLWAPWCAAVVDGEVASVAFAARLSEIGAE
LGLATAPAFRGRGLAAAVTAAWSRLPSLQTRTLFYSTDSDNRASQRVASRLGLTLRGTTL
RVA
Download sequence
Identical sequences Q393R9
WP_011355780.1.41686 gi|78063033|ref|YP_372941.1| 269483.Bcep18194_B2186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]