SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78064902|ref|YP_367671.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78064902|ref|YP_367671.1|
Domain Number 1 Region: 100-248
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.83e-35
Family Reductases 0.041
Further Details:      
 
Domain Number 2 Region: 241-359
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.25e-27
Family 2Fe-2S ferredoxin-related 0.015
Further Details:      
 
Domain Number 3 Region: 3-111
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.77e-24
Family Ferredoxin reductase FAD-binding domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78064902|ref|YP_367671.1|
Sequence length 362
Comment phenylacetate-CoA oxygenase/reductase subunit PaaK [Burkholderia lata]
Sequence
MATPQFHPLRIRDVRPETADAVTVSFDVPPELRDAYRFTQGQFVTLKTHIDGEETRRSYS
ICVGTTDYDRDGELRIGIKRVRGGRFSNFAFDSLQPGHTIDVMTPDGRFFTHLNADHGKQ
YVAFSGGSGITPVLAIVKTTLELEPRSTFTLIYGNRSVDAIMFAEELEDLKNRYMNRFVL
YHVLSDDQQDVELFNGVLDQTKCAEFLGTLTPADAIDEAFICGPAPMMDAAEAALKAAGV
PQAKVHVERFGTPLPQAGAPVVEITDQTPAADLEIVLDGKKRKLRLPYEGVSLLDVGLRA
GLALPYACKGGVCCTCRAKVLEGEVRMEKNYTLEEHEVKDGFVLTCQCHPISDKVVVSYD
ER
Download sequence
Identical sequences Q39KI9
WP_011350660.1.41686 269483.Bcep18194_A3425 gi|78064902|ref|YP_367671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]