SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78065350|ref|YP_368119.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78065350|ref|YP_368119.1|
Domain Number 1 Region: 20-220
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.67e-16
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78065350|ref|YP_368119.1|
Sequence length 224
Comment hypothetical protein Bcep18194_A3876 [Burkholderia lata]
Sequence
MTLAGAFAQAVPRAGERVRFRSADAGDAAACAPLVFASGVAEFGFFLGESDARCIAFLQQ
AFRSRHGRFSWRRHRVAVADDGAVLAVMAIHDGQQTMFDDVHVVWALARCFGVRRTIGQL
LRGLILETEIPAPKRSQILVAHCATDERQRGTGIFSALFRDALDTGALPGDGSRDVVLDV
LTRNVRARVLYERLGFTALPRPRARSRRLPAELDSIRMRLSRRV
Download sequence
Identical sequences Q39J91
269483.Bcep18194_A3876 gi|78065350|ref|YP_368119.1| WP_011351060.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]