SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78065764|ref|YP_368533.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78065764|ref|YP_368533.1|
Domain Number 1 Region: 1-337
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.03e-104
Family AstA-like 0.000000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78065764|ref|YP_368533.1|
Sequence length 350
Comment arginine succinyltransferase [Burkholderia lata]
Sequence
MLFVRPGKLTDLDALAHMARTAQPVLHSLPHDRAALEARVALSEDSFRADVDFAGEEFYL
FVLEDSSTGKLLGTASIVAAAGYSEPFYAFRNDALIHASRELHVNRKIHALTMSHELTGK
SRLAGFYVDPSLRGDAAAHLISRARMMYIAANRRRFTPEVFTLLLGVSDGNGASPFWEAV
GRKFFGRNFTDVDIASGGRSRTFIAEVMPAYPLYVPLLPEAAQRVLGEPNESALLAYDIH
LEEGFEPDRFVDIFDAGPVLTAQVDRTACVKHGAERIVREAAHQQGDVAYMVSTGSGESF
RCVLADLPGDAADAPLASDVRAALDVKDGDVVRCVPLHRRDDEDLKGDAA
Download sequence
Identical sequences Q39I27
269483.Bcep18194_A4292 gi|78065764|ref|YP_368533.1| WP_011351460.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]