SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78066118|ref|YP_368887.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78066118|ref|YP_368887.1|
Domain Number 1 Region: 4-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.58e-56
Family G proteins 0.00025
Further Details:      
 
Domain Number 2 Region: 151-301
Classification Level Classification E-value
Superfamily Translation proteins 2.83e-32
Family Elongation factors 0.0071
Further Details:      
 
Domain Number 3 Region: 399-514
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.23e-28
Family EF-G/eEF-2 domains III and V 0.012
Further Details:      
 
Domain Number 4 Region: 303-388
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000264
Family EF-G/eEF-2 domains III and V 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78066118|ref|YP_368887.1|
Sequence length 608
Comment GTP-binding protein TypA [Burkholderia lata]
Sequence
MTRALRNIAIIAHVDHGKTTLVDQLLRQSGTFRENQQIAERVMDSNDIEKERGITILAKN
CAVEYEGTHINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVEGPMPQTRFVTKKALALG
LKPIVIVNKIDRPGARIDWVINQTFDLFDKLGATEEQLDFPIVYASGLNGYASLDPAARE
GDMRPLFEAVLEHVPVRPADPEAPLQLQITSLDYSTYVGRIGVGRITRGRIKPGQPVAMR
FGPEGDVLNRKINQVLSFTGLERVQVESAEAGDIVLINGIEDVGIGATICAVDTPEALPM
ITVDEPTLTMNFLVNSSPLAGREGKFVTSRQIRDRLMKELNHNVALRVKDTGDETVFEVS
GRGELHLTILVENMRREGYELAVSRPRVVMQEIDGVRHEPYELLTVDVEDEHQGGVMEEL
GRRKGEMLDMASDGRGRTRLEYKISARGLIGFQSEFLTLTRGTGLMSHIFDSYAPVKDGS
VFERRNGVLISQDDGAAVAYALWKLQDRGRMFVKPGDALYEGMIIGIHSRDNDLVVNPIK
GKQLTNVRASGTDEAVRLVPPVQMSLEYAVEFIDDDELVEVTPQSIRLRKRFLKEHERRR
ASREGAVD
Download sequence
Identical sequences A0A0B1YM80 J7J2Y4 Q39H23
269483.Bcep18194_A4648 gi|402566694|ref|YP_006616039.1| WP_011351805.1.41686 WP_011351805.1.68957 WP_011351805.1.69720 gi|78066118|ref|YP_368887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]