SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78066262|ref|YP_369031.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78066262|ref|YP_369031.1|
Domain Number 1 Region: 136-329
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.8e-62
Family N-acetyl transferase, NAT 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78066262|ref|YP_369031.1|
Sequence length 338
Comment hypothetical protein Bcep18194_A4792 [Burkholderia lata]
Sequence
MEDTLTKPAGAADAVEGEVAAALDGAAHGQAMAVVEHTLDAWRPDDSPDGLLAAFVALFN
TDTRYDAATITVPLGGADAAAVASYVARAVREGVIDGAQVAGDTLRVTVSRATFWQNPRP
WLKAPASGGMPLRHVITNGHRHPVRPPSPAGEIYARYMPQVGMTFSLRTVDVDAHADLFS
GWMNLDRVAHFWDQRGTRDEHAAYLAERLADPHMHPMIGYFDDTPFGYFEFYWAKEDRLA
PFYDAHDYDRGLHLLIGDSRFQSAGKLHAWWSGVLHYMFVDEPRTQRLVGEPRVDHVRHI
AYMHRLGFYTLKEFDFPHKRAALTVIERDTFFDTFRLP
Download sequence
Identical sequences Q39GM9
269483.Bcep18194_A4792 WP_011351946.1.41686 gi|78066262|ref|YP_369031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]