SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78067040|ref|YP_369809.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78067040|ref|YP_369809.1|
Domain Number 1 Region: 214-648
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.69e-93
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00015
Further Details:      
 
Domain Number 2 Region: 75-211
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.63e-36
Family Ferredoxin domains from multidomain proteins 0.00014
Further Details:      
 
Domain Number 3 Region: 1-74
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.35e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78067040|ref|YP_369809.1|
Sequence length 776
Comment NADH dehydrogenase subunit G [Burkholderia lata]
Sequence
MVELEIDGKKVEVPEGSMVIQAAHKADKYIPHFCYHKKLSVAANCRMCLVEVEKMPKAVP
ACATPVSAGMIVHTQSDKAVKAQQSVMEFLLINHPLDCPICDQGGECQLQDLAVGYGKSS
SRYSEEKRVVFHKNVGPLISMEEMSRCIHCTRCVRFGQEIAGVMEFGMLGRGEHSEITTF
VGKTVDSEMSGNMIDLCPVGALTSKPFRYSARTWELSRRKSVSPHDSVGANLVVQVKNNR
VMRVLPFENEAINECWISDKDRFSYEGLNSEERLTKPMLKQGGQWIETDWQTALEYVAKG
LKGIAADHGANALAMLASAHSTAEELFLVKQLANELKTPNVDFRLRQQDFSAPVQGAPWL
GMPIADLSNVDAAFVVGSFLRRDHPLFASRLRQAAKNGAKLHFLHATGDDALIPTAQRIV
AAPSAWLDQLAGIAAAVAQLRGVALPDALAGVTASPAAQAVAQSLANGERRAVLLGNVAV
RHPEFAKLHAVAKWIADNTGATFGFLTEAANTVGAHVVGALPGEGGLNAREAFEQPRKGY
VLLNVEPEFDTADPAQALAALNQAEMVVVMSPFKHGLDYADVLLPVAPFTETAGTYVNAE
GTVQSFNGVVRPLGDTRPGWKVLRVLGSVLGLPNFEYETSEEVRLAALGDAGVAGRLSNQ
TSVAPVRVAANAANGGFERLADVPIYHADALVRRAGALHLTTAAKAANAAALPAALFDKL
GLKEGDAVRVRQGERAVQLPAVRDANLAETVVRVSAATPAGAALGSLSGELVVEKA
Download sequence
Identical sequences Q39EF1
gi|78067040|ref|YP_369809.1| WP_011352697.1.41686 269483.Bcep18194_A5571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]