SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78067209|ref|YP_369978.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78067209|ref|YP_369978.1|
Domain Number 1 Region: 195-369
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.62e-38
Family FemXAB nonribosomal peptidyltransferases 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78067209|ref|YP_369978.1|
Sequence length 392
Comment hypothetical protein Bcep18194_A5740 [Burkholderia lata]
Sequence
MKHERIDYRTGILSSPAEVPAEEWNALLARDAQPTPFLRHEFLDALHVARCAVDDTGWSP
HFVTLTDERTGRLAAAAPVYAKQHSYGEYVFDWAWADAYQRNDLPYYPKLLCAVPFTPVQ
GTRLLAADDDARRRLAATLLAFAEQSDVSSLHVLFPTGDEAALLESMGMMLREGVQFHWI
NDGYRHFDDFLGTLEQKKRKNIRAERRKVHDAGVTFRRLTGDQITDADWRFFSRCYRQTY
REHYSSPYLNLDFFRTIGATMPENLLLVIAEADGQPIASALAVYRRGENGGGTLYGRYWG
AVEHVPCLHFETAYYQLLEFCIEAGLDTFEGGAQGEHKLARGFLPTVTHSAHWLAHPAFS
DAVARFLERETEHIHAYVDELREHDPFRRGAE
Download sequence
Identical sequences Q39DY2
269483.Bcep18194_A5740 gi|78067209|ref|YP_369978.1| WP_011352859.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]