SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344204883|ref|YP_004790025.1| from Mycoplasma putrefaciens KS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344204883|ref|YP_004790025.1|
Domain Number 1 Region: 542-615
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 1.83e-17
Family Glucose permease domain IIB 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344204883|ref|YP_004790025.1|
Sequence length 665
Comment PTS system component, glucose subfamily protein [Mycoplasma putrefaciens KS1]
Sequence
MQTKMQPKAFSARLKNFGANIMPTLSKLSKAFLLPIALLPIAGIFLGVGATITTNTAESS
FIWYVGNVMKAMGEVCFGNLPVFFCISVALAYTKDSGIAALTAVVGFLVFNAIQSALLTG
GPKNADDLTATYNLLWYHGDKWGVPQKLISENLGIKSLNTGVIAGIFVGAISAKVYNKFH
DIQLPSAISFFSGTKFVPIVTFAVVAPLSLIFAMTWPVIGIGFAWVGENSGKLPYGTDSL
IFEVVERSLVPFGLHHVFYAPLWWTSAGGSIAEALTAMQSQPMEVQMKFIEAYKQMHGAS
NVSDLNSIITLVKNSKDLYAAVGDQFMGQQILANSNIFNFTDAQNLGLNVGRFQSGKFGF
MLLGLPAAALAMWLAVPTQNRKQVFGIYFSAAFTCFLTGITEPIEYTFLFVAPWLFYGVH
MPLASIAFWITGALQTHVIQTVSGGFIDYIIFAVIPFFGSRAMTALSAFGVLAVAVGLAP
VYFFAFYFLIKKFNVKTPGRDGQTDNVQLYTKADYKASKEMNTDGSKLKSIDDKEAARMA
KAAAIIEYLGGEANILDVDSCASRLRLTVVDSSKANIDGIKSLGGTTGALVKGNNIQIVY
GGEQEAIKPRMIKILGQQRSGKKSEVKIEVQKQPNVEKPVAKKATSTTKKPSSVTKSSTK
STTKK
Download sequence
Identical sequences WP_014034877.1.288 gi|344204883|ref|YP_004790025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]