SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344204976|ref|YP_004790118.1| from Mycoplasma putrefaciens KS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344204976|ref|YP_004790118.1|
Domain Number 1 Region: 4-199
Classification Level Classification E-value
Superfamily DhaL-like 1.57e-44
Family DhaL-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344204976|ref|YP_004790118.1|
Sequence length 549
Comment dihydroxyacetone kinase 2 domain-containing protein [Mycoplasma putrefaciens KS1]
Sequence
MEQIKILNNMILSGVNNLYNHYPYIDKLNVFPVPDGDTGTNMNLTISNGYAEIENNQTDY
TSIGKFLSDFARGLIMGARGNSGVIFSQIIKGFSLGMNNSEELSVEQWKQGFNKACEVAY
KAVMKPVEGTILTVIRETSEKLNELDNTTDINQFWKIAIEQANSSLENTPNLLPVLKEVG
VVDSGGYGLVKFLEGMQSYLENGKVVPKLAKLEINEGQNIELETDEEFGYCTEAVVILNK
EWISKLQVATIRDQLQIYGNSSIVVVVDEDILKVHTHALTPGQVLLFLQQYGDFLTLKIE
NMSIQADKQVKGRKSKWKETSEIKTVRNLVNDTAIISVVPSKQLKSYFEKDLGIDLAINA
GSKMNPSTEDFLQAIQEVDAKNVFIFPNNNNVYLTAKQAEKLEKKSKVYVLQTKTIQQGM
VCALSYDPSVVPSKNSSQLLKAIKNVISFSVSKAIKDSTIDGVSVKKNNFIAVVDGKIVG
SEKTMKAIYEKQLSKYIKNKTEIITIFTGEETDEKDITQLRKFLDEKYNVEYEIIEGGQK
VYSLLLALE
Download sequence
Identical sequences M9WHI8
WP_014034970.1.288 WP_014034970.1.54435 gi|482887965|ref|YP_007885135.1| gi|344204976|ref|YP_004790118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]