SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344205096|ref|YP_004790238.1| from Mycoplasma putrefaciens KS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344205096|ref|YP_004790238.1|
Domain Number 1 Region: 153-333
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.68e-49
Family G proteins 0.0000111
Further Details:      
 
Domain Number 2 Region: 2-158
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 5.89e-49
Family Obg GTP-binding protein N-terminal domain 0.00000916
Further Details:      
 
Domain Number 3 Region: 360-432
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 4.71e-18
Family Obg GTP-binding protein C-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344205096|ref|YP_004790238.1|
Sequence length 432
Comment GTP-binding protein Obg/CgtA [Mycoplasma putrefaciens KS1]
Sequence
MKFVDSAEFVIKAGKGGDGAVSFHHALFVPNGGPNGGDGGDGGSVYIQGDTGKHSLLDLK
LQKKYQAEDGKKGDIKNMHGAKGEDKIIRVPVGTVLFNKNTGQILADINHEKKTVLIAKG
GKGGRGNARFANSRNKAPTIFEAGEPGQEWQIKAELKVLADVGFIGKPNAGKSTLLRAVS
NSKPEVADYPFTTLNPQLGVAKAKNGDTFIVADLPGLIKGASLGKGLGHQFLKHIERCRV
ICHVLDMSGNYGSEDVIENYQLVRDELTAYNLNLEKRPEIIVFNKMDLDEAQLNLMDQKI
LDYFKDKNTVQISGLKKKNIDQLLLEISKVLKTAKDAPLWELDEQDTDEIVVYTFEEDKP
DIQIFNKGNGRWEVSGETILKIYQKFPIWTDDNLLMFNERLKKTGLYKMLEERGIKKNDL
VKIFDYELEWVD
Download sequence
Identical sequences gi|344205096|ref|YP_004790238.1| WP_014035090.1.288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]