SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344205258|ref|YP_004790400.1| from Mycoplasma putrefaciens KS1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344205258|ref|YP_004790400.1|
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.29e-33
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0014
Further Details:      
 
Domain Number 2 Region: 171-270
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.05e-32
Family PTS system, Fructose specific IIB subunit-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344205258|ref|YP_004790400.1|
Sequence length 801
Comment PTS system fructose specific enzyme IIABC component [Mycoplasma putrefaciens KS1]
Sequence
MIEKVCDKDFIFLDVDLKTKRETFEFIAQKASELKILTNKKALVDGFVKREMQGSTGFED
GFAIPHARIKQLKRTAVFVIRFKHEVDWGSMDGQKTKVAIALLVVDGSNGDQHIELLSQI
AVKLIDPDFKEILKKSRTYKAILEALQNQQQTTSTKNLDQPEVKISKSNHKIVAVTSCVV
GIAHTYMAEEKLLQAGLKTNNHIRVETQGSKGVGTELTKKEIKEAEVVIIAADTAVDLSR
FAGKRIYKSKVAEAIKDPELTIQKALESAVVLSPKNKDFEIRNRQKEEKTGILQHVLVGI
SYMVPIIILGGICLSVSVGVTKAINGANASPVGFLKVIETIGVAAFMLMIPVLAGFIANS
IAGRSAIAPAMVGAFIGNNATNFVNWIPGLNQIQTPMGFVGAIIAGLVVGYFVRWVNTWK
GPKTLAPAMPIFFVPLTAGILISLLFIYALGAPIGFVMEKFSNFIKQTYQKQNIGLVLGL
GLGVLVGAMAGFDMGGPINKIAFVTCSALITQQIYEPMGAMAAAIPVAPLGMGLATVIFK
KFFNSAERQMGLAALIMGMIGISEGAIPFAIRDPKRAILCNVLGSAIAGGIAGALKVQDT
AAHGGPIVGILGAVPYGIQTVYFFLAIIIGSVITCVSYGLWLLAGVTEKDSVKWAYQMAL
SNLKQVRKTKLKALKAEINSLKKQTNDKAKLLSLANQVSETKVKFDRDLQQLKATFKKYQ
KEEDQLLKSHKTEISNYKNQVNQRLTKDIQTINQANDRSDKKSSSAQIIKLKDLAKEQID
NYSKDLKKPIVNKFLQENNLL
Download sequence
Identical sequences gi|344205258|ref|YP_004790400.1| WP_014035251.1.288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]