SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|403515299|ref|YP_006656119.1| from Lactobacillus helveticus R0052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|403515299|ref|YP_006656119.1|
Domain Number 1 Region: 256-599
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.86e-85
Family beta-Lactamase/D-ala carboxypeptidase 0.00000067
Further Details:      
 
Domain Number 2 Region: 65-255
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 6.15e-46
Family Penicillin binding protein dimerisation domain 0.0000347
Further Details:      
 
Domain Number 3 Region: 664-718
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0023
Further Details:      
 
Domain Number 4 Region: 603-661
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000484
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|403515299|ref|YP_006656119.1|
Sequence length 719
Comment penicillin-binding protein 2B [Lactobacillus helveticus R0052]
Sequence
MKKNSNLKLQKSKAHSYRFTVGRVLQVAVALVFLVFTARFLYIGISKTVNGQNLSQRTKQ
LYKRNEVIKASRGTIYDCNGLAIAEDSHLYTVYAILDKSSINYKNKPEYVVNKSETAEKL
AKVLPLSADKIYQYLNPKHKAFQVQFGTGGSGLTLKQKKQIEAMKLPGIKFVATPSRLYP
NGNFASHIVGLAQPEYNKKTNSEMLVGTMGLEAYFNDTLTGKDGYRISTVDASENQSPNQ
NQVYKPVENGNNLYLTLNSQLQSYLEARLTEVQKAYDPTSITAVVEDMKTGKVLAASQRP
TFNPQTKKGLTKSYRNILVQDTYEPGSVFKVLSFAAAVNSGNYNPNEYYRSGSVSIGGST
IHDWLTSGWGTIPFSQAFERSSNTGFVKLEQKMGSKTWKKYLKRFHIGEKTGITLPGEQP
GFISFKTPVDQAVTAFGQGVNVNVMQMMQAYSSLGNNGQMVKPQLVDKVTDFNGKTIKGY
QIKKVGTPIYSAKIKRVVLANMRKVLNKQSGTGSAYKMGNADIGVKTGTAQIANPKGGGY
LKGDSNYIFSVVGVYPTKNPRYCIYLTIKQPHLAGTTAEKILASIFKPMMSRIITMAKSN
NSTTTVTVPNFKDMTVAQASAKAKQIGLNLVKVGEKDKITAQGIKSGEKLESGDKIFVYT
SGKINCPDMKGWSFNDLHQFSNVSGVKLSIKGTGTVASQSVAKGTELKSGEKIKVNLKE
Download sequence
Identical sequences J3ZET6
gi|403515299|ref|YP_006656119.1| WP_014919035.1.21552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]