SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|403515236|ref|YP_006656056.1| from Lactobacillus helveticus R0052

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|403515236|ref|YP_006656056.1|
Domain Number 1 Region: 13-111
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.05e-36
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|403515236|ref|YP_006656056.1|
Sequence length 120
Comment PTS system cellobiose-specific transporter subunit IIA [Lactobacillus helveticus R0052]
Sequence
MAEEKQTPEQKEQETLMAAMGLIANGGNAKSLAFEAIRLAKKGDIEGAREKLKESDKSLL
EAHNSQTNMLTKEAQGDHMHVTLLVVHSQDHLMNAITFRDLAGEMVDLYEKLYESGSLKK
Download sequence
Identical sequences A0A0R1NFN8 A0A0R1NWI3 A0A1Y4UKC4 A0A226U5J7 A0A2A7QJ35 J4BR56
WP_014918983.1.100755 WP_014918983.1.18059 WP_014918983.1.20145 WP_014918983.1.21552 WP_014918983.1.28546 WP_014918983.1.30858 WP_014918983.1.41696 WP_014918983.1.55028 WP_014918983.1.63631 WP_014918983.1.85968 gi|403515236|ref|YP_006656056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]