SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452206466|ref|YP_007486588.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452206466|ref|YP_007486588.1|
Domain Number 1 Region: 225-326
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000561
Family Retroviral integrase, catalytic domain 0.031
Further Details:      
 
Domain Number 2 Region: 37-143
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000179
Family Homeodomain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452206466|ref|YP_007486588.1|
Sequence length 340
Comment ISSod10-type transposase [Natronomonas moolapensis 8.8.11]
Sequence
MARLEKVSVEDLRQILAEVDEADAAKRIMAAITYKEIDDLTQTDAAELYGFSSSWASKWF
TRLERLADEPFEEVVYDKPREGRPSELSDKEHDQFVEALHDSPGEVRYDAPAWSVPLARH
YLSEEFGVEYCERHVRRLISEAGLSWKTARPEFYKSDERAQEAWQEGFKKKRDNLDDEYT
ILTIDQTRQVLSTLIYAWFPEGERPSLPVTGAWDSIKLLGAVSDSRETFFLPCAENFNSD
TTIRLLDALQTEFGKKICVILDNASYFTANAVQEFVEDTPIELCYLPRGSPELNPAEECW
RQLDQELGNRLFDTLDELRDAALCALNRITVPDVFTYLCP
Download sequence
Identical sequences M1XKG0
gi|452206466|ref|YP_007486588.1| gi|452207366|ref|YP_007487488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]