SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452206971|ref|YP_007487093.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452206971|ref|YP_007487093.1|
Domain Number 1 Region: 11-139
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000108
Family Cgl2762-like 0.075
Further Details:      
 
Domain Number 2 Region: 232-324
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000784
Family Retroviral integrase, catalytic domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|452206971|ref|YP_007487093.1|
Sequence length 334
Comment ISSod10-type transposase [Natronomonas moolapensis 8.8.11]
Sequence
MNHLDEISVEELQDALDNVDEKKPTQRLLAAIAYKNGVSQTELAEWYDVQRRTIYSWLKR
LDTDESLGQAVSDAKRTGRKRKLSESQLKEFEETVHEPPDEVGIDAPAWTPALAQNFLEE
TYGVEYSVSSCRRLLKEAGLSHQKPRRTAAETDEDEQDRFHDELKKKATGAGRHGSLYRS
NKKKSVQVEPRAAWFPRGTRPSVELSGQRDWTCLLGAITEDGDRFFSRFTEYVTAEHAKH
FILALCKEFEDDLIVVLDGAPYFQASAVTDLAARDDLTFVTLPSYSPELNPVEECWRQVQ
KALSNRFFDSLDELTTAIDTALDKLSVPTVSNYF
Download sequence
Identical sequences M1XQF3
gi|452206971|ref|YP_007487093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]