SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452207065|ref|YP_007487187.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452207065|ref|YP_007487187.1|
Domain Number 1 Region: 15-242
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.1e-59
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000218
Further Details:      
 
Domain Number 2 Region: 331-491,792-858
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.32e-36
Family Intein (protein splicing domain) 0.013
Further Details:      
 
Domain Number 3 Region: 925-1082,1501-1565
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.69e-30
Family Intein (protein splicing domain) 0.0097
Further Details:      
 
Domain Number 4 Region: 1581-1701,2061-2103
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.95e-29
Family Intein (protein splicing domain) 0.058
Further Details:      
 
Domain Number 5 Region: 2101-2311
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000596
Family Extended AAA-ATPase domain 0.014
Further Details:      
 
Domain Number 6 Region: 567-658
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000034
Family Intein endonuclease 0.043
Further Details:      
 
Domain Number 7 Region: 1162-1262
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000108
Family Intein endonuclease 0.033
Further Details:      
 
Domain Number 8 Region: 1815-1903
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000907
Family Intein endonuclease 0.018
Further Details:      
 
Domain Number 9 Region: 481-552
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000808
Family Intein endonuclease 0.029
Further Details:      
 
Domain Number 10 Region: 677-733
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000533
Family SinR domain-like 0.03
Further Details:      
 
Domain Number 11 Region: 746-785
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000614
Family Phage repressors 0.027
Further Details:      
 
Weak hits

Sequence:  gi|452207065|ref|YP_007487187.1|
Domain Number - Region: 273-331
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000293
Family Extended AAA-ATPase domain 0.067
Further Details:      
 
Domain Number - Region: 1275-1331
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.016
Family SinR domain-like 0.071
Further Details:      
 
Domain Number - Region: 1348-1386
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0762
Family SinR domain-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452207065|ref|YP_007487187.1|
Sequence length 2389
Comment ATP-dependent DNA helicase MCM (intein-containing) [Natronomonas moolapensis 8.8.11]
Sequence
MARAEDTEVIDKFETFYRDYYRNEIGQLAQKYPNEKRSLYVDWNDLYRFDPDLADDFIAQ
PDQMLEYAEEALRLYDLPVDVKLGQAHVRVQNLQRTTGIRDIRARHRGQLVEVSGIVRKA
TDVRPKVIEAAFECQRCGTLTRIPQTSGEFYEPHECQGCERQGPFDINFDQSEFVDAQKL
RVQESPEGLRGGETPQSIDVHIDDDITGRVTAGDHVRVTGVLHLEQQGSNQEKSPVFDVY
MDGMAVEIEDEQFEDMDITDEDKKRIIELSNESDIYEKMIASMAPSIYGYDQEKLAIIMQ
LFSGVTKHLPDGSRTRGDLHMLLIGDPGTGKCLKSDTKVSLPDGTQREIGKLVEGNLDDP
TPVDDGFYQKCFIPVLTTDGRRIVPGTASKLWKRQTPERMYNIRTESGNTLEVTPSHPLF
RQIEGRLEPTTASELEEGDFIATPTELPSEPDESIDIQYAPSESPNANRLHAPETLTDGV
ARLIGYVVGEGHISGGEFSQEVTVTNADEEILEDVSTVLGSLGLRYRRQPHQTKPSVSTV
RCSSVELARFFEALEPNMLERSAHQRVPDVVLRARPQRKAEFLRAYVDGECTVSPKEREI
VVASMSEELLEDVQSLLLSFGIQSQLHPRNNDSYRLRISGADFERYVGRIGFVTERKAVS
AAEFDDVEANTNTDVVPNVGGTLRDVREALALSQFDCGVPRTTYQHYERGDRNPSRSTLH
TVLNAFEARTERLSALRERVTDGGWDAIVTARDELGISQAALADGMDVSQTAISYYERNE
VAPDGGCVMDASGVVLDRLDAALSVAEDIDRLRALAESDIGWDRIDSIEAVDPDYEWVYD
LEVEGTHTYISNNVVSHNSQLLQYIRNLAPRSVYTSGKGSSSAGLTAAAVRDDFGDGQQW
TLEAGALVLADQGIAAVDELDKMRCVTGDTLVHLSDGRLSRINELAREAKQGGTIEELPN
GRTIRNIDLTAWTMSDTGRLVERPITAIHEYGAPEELTEITLESGERISATHDHPFFVFE
DGKRHKRPATDLEPGDWTYVPKQLSEPTTDGGIASDSGGGSISSHNVQPSFGAVLGYLSG
DGNVYYNRHEERYGIRFINNQEELLQDFEQACIDAFGKVPVRHPSGQRNDGVETVRLHGR
EYADRVLDAGMNVETHDDKSFPTRVTTGTRRTKAAFIRAFADSEGNVDSSTGNVRMYSAS
GEILLGIKSLLLEFGISCQIRTRERSEKRDIHVLGITSAESIRSYNRHIGFTLERKQDAL
AEVCASVDGDRTTIDVLPDCGDLLRDVRASLRLHQSECGIDGTTYCNFENGDANCSLHRA
STILEAFEKRIETANRDTEVLVDDCNWDSLQRLKDRYHVSQGELANGTALSQQQISKGWE
NSEDVREIVRAELHRLVVDVSNTELSPLDDLINGDVKWRRVRSVDTVVSGPKNDRIPILQ
QELADVLDSPPAEVTSRAQELLDRNCKIESWTTLRDELDTYGIPLWVLGSDLGVTGLTIS
RWSNGIVETDRFEEVKTAAENRISEKCSKIRKLLNEIESRREANVYDLTVEGTHNFVANG
MVVHNSEDRSAMHEALEQQSYHPDTELLLADGRRVDIGEFVDTRMQEHPERVTDGVDCEI
LPVEDVRVHSTDFETNETTKLPVDRVSRHEAPEEFVRVSFSNGREVTVTPEHPMFVDDGG
EIGTVEADDIEVGAFVPAPRKLPNSSAAVELDGEPHRGKEKDVRLPAELSGDLAEILGFL
VAEGHAYAGSTHEIGFSSHDERLLERMDRLVQSVFGVESTDTTNAAGTVTKRWVSTELYR
WFQRNVPGVMETARDRRVPDRVLGASEEAIRRFLVGAFAGDGGVESEAMSFSTASDGLAE
DYADALAKVGVASRIHHDATEDSWKVYVMGDSTERFVDSIVDPADERYEEAQAFVERSNE
ARRHHDVLPTSAARELRDLKRLLGVGRTGKFRTHFDEGYGIQIETVREELEALRTRAEEV
ERAIQQAETLAEIRAVVGWSGRQLADRIEGATTGTIHYAESGGYDAARRSELADHARNAA
YAALDEFDNRAGRLDDRCDLRYYRVTDVETIPNEGEDACEWVYDVTVEPTNTFVSRGVVL
HNSISISKAGINATLKSRCSLLGAANPKYGRFDQYEPIGEQIDLEPALISRFDLIFTVTD
QPDAEEDANLAEHIINTNYAGELHTHRENTTTSNVSEEEVENVTEDVEPEIDAELLRKYV
AYAKRNCYPMMTEEAKAEIRDFYVDLRAKGQDEDAPVPVTARKLEALVRLAEASARMRLS
DTVDSGDAERVIEIVRSCLQDIGVDPETGEFDADVVETGQSKTQRDRIKNVKSLIAEIES
EYDEGAPIETILDRAEEVGMERSQAEHEIEKLRRQGDVYEPTTDHLRTV
Download sequence
Identical sequences M1XKT0
gi|452207065|ref|YP_007487187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]