SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452207390|ref|YP_007487512.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452207390|ref|YP_007487512.1|
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000856
Family CopG-like 0.021
Further Details:      
 
Weak hits

Sequence:  gi|452207390|ref|YP_007487512.1|
Domain Number - Region: 37-85
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00777
Family FIS-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|452207390|ref|YP_007487512.1|
Sequence length 122
Comment conserved hypothetical protein [Natronomonas moolapensis 8.8.11]
Sequence
MARITGSYPDDLDLLIEGAVEAGVFGGKSDALREFVRDYFEDHENERIAAVVALYERERI
TLGEAARLADVDRWTMRDLLREHGIELRLGLLDEDDAAYEVEAAKELEFDNEDSDGEESP
AK
Download sequence
Identical sequences M1XRF2
gi|452207390|ref|YP_007487512.1| WP_015409568.1.26724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]