SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452208315|ref|YP_007488437.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452208315|ref|YP_007488437.1|
Domain Number 1 Region: 55-202
Classification Level Classification E-value
Superfamily PRTase-like 5.77e-24
Family Phosphoribosyltransferases (PRTases) 0.024
Further Details:      
 
Weak hits

Sequence:  gi|452208315|ref|YP_007488437.1|
Domain Number - Region: 7-36
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0538
Family Tetracyclin repressor-like, N-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452208315|ref|YP_007488437.1|
Sequence length 212
Comment homolog to orotate phosphoribosyltransferase [Natronomonas moolapensis 8.8.11]
Sequence
MKNIDGLIESARELSERGFSRGEIADELNVSRETATWLVERSGEAASTTTEPSGGPHDIH
VDWSALGRDSARLSYTGMAMADLLSKQGESVDLTVGIEKAGAPLATVVARELDTDIAAYA
PRKHQWEEGDIEELEGTFSQNFAEIRGRECYVVDDTITSGTTMRETIGGIKNRGGEPVAC
VVLVDKQGIESIDGVPVYSLIQAIRVGNGDDE
Download sequence
Identical sequences M1XTF2
gi|452208315|ref|YP_007488437.1| WP_015410490.1.26724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]