SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452208446|ref|YP_007488568.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|452208446|ref|YP_007488568.1|
Domain Number - Region: 17-67
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0468
Family Intein endonuclease 0.068
Further Details:      
 
Domain Number - Region: 116-168
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0794
Family Intein endonuclease 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452208446|ref|YP_007488568.1|
Sequence length 223
Comment conserved hypothetical protein [Natronomonas moolapensis 8.8.11]
Sequence
MSPDTDAGTPADLLESHPETAYFWGRVVGDGEATERGVSVRATDETAADRLAAIAGSDDV
DHRVDEREYAHDTSITRREDSYTVRLEGPIGDRAAAALGLPIGDDPGGYRLDALAEYDRQ
LLRGLLEGCGTVCFKSSEGTVGVSFVHDDRAALESIQGLLDAADVDAPYGELSETSSGGY
WFGLDDAAAPALGEWLYAGSDSSGLFAPSRRRKLRRSVEEAEY
Download sequence
Identical sequences M1XLK7
WP_015410620.1.26724 gi|452208446|ref|YP_007488568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]