SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452208571|ref|YP_007488693.1| from Natronomonas moolapensis 8.8.11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452208571|ref|YP_007488693.1|
Domain Number 1 Region: 16-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000215
Family Alr1493-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452208571|ref|YP_007488693.1|
Sequence length 97
Comment conserved hypothetical protein [Natronomonas moolapensis 8.8.11]
Sequence
MSKSECRIVSGEESEIHDEPHIGGRRLTVRFVHDRIEGRGLDPGTVADRHDLDVADVYQA
LAYYHDHPDEMSEAERRRRETIGQHEDELVGPGDVGS
Download sequence
Identical sequences M1XLN2
WP_015410745.1.26724 gi|452208571|ref|YP_007488693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]