SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33601529|ref|NP_889089.1| from Bordetella bronchiseptica RB50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33601529|ref|NP_889089.1|
Domain Number 1 Region: 156-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.12e-72
Family Methylesterase CheB, C-terminal domain 0.000000161
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.42e-28
Family CheY-related 0.00000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33601529|ref|NP_889089.1|
Sequence length 350
Comment chemotaxis-specific methylesterase [Bordetella bronchiseptica RB50]
Sequence
MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELIKKHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLIEYS
EVIADKIRAASRARLRAPAPAGHAAPLRLRSPFASSEKLVIVGASTGGTEAIREVLQPLP
ADSPAILITQHMPAGFTRSFAQRLDALCAVTVREASDGERVLPGHVYLAPGGETHMRLGR
SGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVILTGMGKDGAAGLLAMKRAG
ARTMAQDEASCVVFGMPREAIALGAADEVVPLADISERILTRLGDRGHRV
Download sequence
Identical sequences A0A063TYN2 A0A0C6NZU5 A0A1M9MWS2 Q7WJE7
gi|412337698|ref|YP_006966453.1| gi|33601529|ref|NP_889089.1| 257310.BB2550 WP_003811913.1.14246 WP_003811913.1.15674 WP_003811913.1.1660 WP_003811913.1.17334 WP_003811913.1.17359 WP_003811913.1.19828 WP_003811913.1.20111 WP_003811913.1.21837 WP_003811913.1.22732 WP_003811913.1.23701 WP_003811913.1.24339 WP_003811913.1.27032 WP_003811913.1.29688 WP_003811913.1.30681 WP_003811913.1.31246 WP_003811913.1.31572 WP_003811913.1.31632 WP_003811913.1.32589 WP_003811913.1.33898 WP_003811913.1.37794 WP_003811913.1.38534 WP_003811913.1.40806 WP_003811913.1.42576 WP_003811913.1.43400 WP_003811913.1.43447 WP_003811913.1.50287 WP_003811913.1.54628 WP_003811913.1.56782 WP_003811913.1.5701 WP_003811913.1.57255 WP_003811913.1.58338 WP_003811913.1.63136 WP_003811913.1.63299 WP_003811913.1.63717 WP_003811913.1.63791 WP_003811913.1.64622 WP_003811913.1.65401 WP_003811913.1.66177 WP_003811913.1.67928 WP_003811913.1.69310 WP_003811913.1.69835 WP_003811913.1.71104 WP_003811913.1.71382 WP_003811913.1.71489 WP_003811913.1.72041 WP_003811913.1.72199 WP_003811913.1.72302 WP_003811913.1.78117 WP_003811913.1.82663 WP_003811913.1.84958 WP_003811913.1.84976 WP_003811913.1.86585 WP_003811913.1.87218 WP_003811913.1.88542 WP_003811913.1.91389 WP_003811913.1.93987 YP_006966453.1.84680 gi|410420357|ref|YP_006900806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]