SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33603953|ref|NP_891513.1| from Bordetella bronchiseptica RB50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33603953|ref|NP_891513.1|
Domain Number 1 Region: 129-280
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.53e-35
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.006
Further Details:      
 
Domain Number 2 Region: 63-113
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000108
Family AraC type transcriptional activator 0.012
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000851
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33603953|ref|NP_891513.1|
Sequence length 281
Comment AraC family transcriptional regulator [Bordetella bronchiseptica RB50]
Sequence
MKPKTRLYYAERLEPVLAWLAARPDADADLHRLAELACLSPYHFHRVYRALMGETVHATV
QRMRLARASVALAQGKGSLRQVADRAGYASEAAFSRAFSAQYGLPPGRYRAKRSSPFNPE
ELRMYPLTMEDFPGLSLATLAHQGDYQEIGNTFDRLALLAATQDLVRDGMQPPPRYIGVY
YDDPAQVARDALRSRAGVSLPPGTAAPAPFEPLDIPAMRCAVLEYTGPYSEIEAPYNWLF
SQWLPASGQEPGDFPMFEEYLNDPKTTPAAQLKTRIYLPLA
Download sequence
Identical sequences A0A063TNX3 A0A0C6P9T5 A0A0H3LS29 A0A1M8IKG8 K0MPT9
257310.BB4979 gi|412340731|ref|YP_006969486.1| gi|410474953|ref|YP_006898234.1| WP_003816010.1.14246 WP_003816010.1.15674 WP_003816010.1.1660 WP_003816010.1.17334 WP_003816010.1.17359 WP_003816010.1.19828 WP_003816010.1.20111 WP_003816010.1.24339 WP_003816010.1.27032 WP_003816010.1.29688 WP_003816010.1.30681 WP_003816010.1.37794 WP_003816010.1.40806 WP_003816010.1.50287 WP_003816010.1.54628 WP_003816010.1.57255 WP_003816010.1.63717 WP_003816010.1.69310 WP_003816010.1.71104 WP_003816010.1.71382 WP_003816010.1.71489 WP_003816010.1.72199 WP_003816010.1.72302 WP_003816010.1.78117 WP_003816010.1.82663 WP_003816010.1.84958 WP_003816010.1.84976 WP_003816010.1.86585 WP_003816010.1.87218 WP_003816010.1.88542 WP_003816010.1.91389 WP_003816010.1.93987 YP_006898234.1.34978 YP_006969486.1.84680 gi|33603953|ref|NP_891513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]