SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33595996|ref|NP_883639.1| from Bordetella parapertussis 12822

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33595996|ref|NP_883639.1|
Domain Number 1 Region: 450-554
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33595996|ref|NP_883639.1|
Sequence length 563
Comment sulfate transporter [Bordetella parapertussis 12822]
Sequence
MPHSVACLDLRVIALLEAKRAGLLRRAHWLPNIVSGLIVGVVALPLAMAFAIASGAKPEQ
GLYTAIVAGLLVSLCGGSRVQIAGPTGAFIVILAGITAQHGVAGLQLATLMAGCILLALG
AARLGAIIKYIPAPVIVGFTAGIGVIIWVGQWKDFFGLPSPAGTHFHEKLWQLVHSLPQL
HLATTALAALSLALLLLNNRLPYLRRVPGPLVALVVATTLQAVLGLDGVATIGSAFGGIP
QGLPSWQWPEITVSRVIELIGPAFAIAMLGAIESLLSAVVADGMAGTRHDSNQELVGQGL
ANIVAPLFGGFAATGAIARTATSIRNGGTSPLAGVVHCITLLLMVLLLAPLAENVPLAAL
AAILFVVAWNMSDAPHFVRMIKRAPRADVAILLVTFVLTVFADLVVAVNIGVVIAILHFL
RRMASSVQVQAQSPAELGDELGHRGYGPLPDDVLVYAVEGPLFFGAAENFERALAATHTD
PRTLIIRLRWVPFIDITGLQALEEVITDLQRRGVRVILSGANPRVKAKLHRAGLVGLAGA
DNVFDRFEDAVLSCRAPAAPATA
Download sequence
Identical sequences A0A2J9U0Z0 Q7WAN8
GO.9075 257311.BPP1336 WP_010927986.1.23657 WP_010927986.1.26498 gi|33595996|ref|NP_883639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]