SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33596130|ref|NP_883773.1| from Bordetella parapertussis 12822

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33596130|ref|NP_883773.1|
Domain Number 1 Region: 156-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.59e-73
Family Methylesterase CheB, C-terminal domain 0.000000167
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.42e-28
Family CheY-related 0.00000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33596130|ref|NP_883773.1|
Sequence length 350
Comment chemotaxis-specific methylesterase [Bordetella parapertussis 12822]
Sequence
MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELIKKHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLIEYS
EVIADKIRAASRARLRAPAPAGHAAPLRLRSPFASSEKLVIVGASTGGTEAIREVLQPLP
ADSPAILITQHMPAGFTRSFAQRLDALCAVTVREASDGERVLPGHVYLAPGGETHMRLGR
SGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVILTGMGKDGAAGLLAMKRAG
ARTMAQDEASCVVFGMPREAIALGAADEVMPLADISERILTRLGDRGHRV
Download sequence
Identical sequences A0A2J9U0U2 Q7WAA4
WP_010928056.1.23657 WP_010928056.1.26498 257311.BPP1476 gi|33596130|ref|NP_883773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]