SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|33598670|ref|NP_886313.1| from Bordetella parapertussis 12822

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33598670|ref|NP_886313.1|
Domain Number 1 Region: 16-94
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.57e-17
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33598670|ref|NP_886313.1|
Sequence length 105
Comment ferredoxin [Bordetella parapertussis 12822]
Sequence
MPIVVFHKGDETFADEVKDNTNLVVRAGIKQFPYPNLRYQCGMGKCATCACRILAGGEHL
PEPNWKEKKQLGDRLAQGYRLACQLWITHDIELRQDAAAPAGGGD
Download sequence
Identical sequences A0A2J9U530 Q7W366
WP_010929422.1.23657 WP_010929422.1.26498 257311.BPP4181 BpR241 gi|33598670|ref|NP_886313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]