SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33598876|ref|NP_886519.1| from Bordetella parapertussis 12822

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33598876|ref|NP_886519.1|
Domain Number 1 Region: 129-280
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.62e-34
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.007
Further Details:      
 
Domain Number 2 Region: 63-113
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000108
Family AraC type transcriptional activator 0.012
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000851
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33598876|ref|NP_886519.1|
Sequence length 281
Comment AraC family transcription regulator [Bordetella parapertussis 12822]
Sequence
MKPKTRLYYAERLEPVLAWLAARPDADADLHRLAELACLSPYHFHRVYRALMGETVHATV
QRMRLARASVALAQGKGSLRQVADRAGYASEAAFSRAFSAQYGLPPGRYRAKRSSPFNPE
ELRMYPLTMEDFPGLSLATLAHQGDYQEIGNTFDRLALLAATQDLVRDGMQPPPRYIGVY
YDDPAQVARDALRSRAGVSLPPGTAAPAPFEPLDTPAMRCAVLEYTGPYSEIEAPYNWLF
SQWLPASGQEPGDFPMFEEYLNDPKTTPAAQLKTRIYLPLA
Download sequence
Identical sequences A0A2J9U4F0 Q7W2L3
APC20439 WP_010929549.1.23657 WP_010929549.1.26498 gi|33598876|ref|NP_886519.1| 257311.BPP4393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]