SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33598358|ref|NP_886001.1| from Bordetella parapertussis 12822

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33598358|ref|NP_886001.1|
Domain Number 1 Region: 98-215
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.57e-29
Family Aromatic dioxygenase reductase-like 0.00057
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.59e-25
Family Ferredoxin reductase FAD-binding domain-like 0.00026
Further Details:      
 
Domain Number 3 Region: 207-309
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33598358|ref|NP_886001.1|
Sequence length 318
Comment iron-sulfur oxidoreductase subunit [Bordetella parapertussis 12822]
Sequence
MLNLCVRSITYEAEGIRSFELVHPLGKDLPPFEAGAHIDVSIPGGFTRQYSLCDPSWQRK
HYRIAVLEDRGGRGGSVALHTALRAGEMIEVSEPRNLFPLDSGAGHKVLLAGGIGITPVL
AMAEALQRSGHSFELHYCTRSPERTAFRERLQTLAAQDKAFFHHDMGDPARGLDIAALLA
RPEPGSQLYFCGPPGFMKAVQAASAHWPQGSVHYEYFGVNPALTEKLAGTGQVAGEVRLA
KSDRILAVRPGQTLLQAIREAGVACESSCESGVCGTCKVRYFSGQPEHNDYVLSDEERTE
FVLVCCAGAGPQALLLDL
Download sequence
Identical sequences A0A2J9U5V7 Q7W422
257311.BPP3849 gi|33598358|ref|NP_886001.1| WP_010929276.1.23657 WP_010929276.1.26498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]