SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470225471|ref|YP_007624050.1| from Staphylococcus aureus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470225471|ref|YP_007624050.1|
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.14e-17
Family Rob transcription factor, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470225471|ref|YP_007624050.1|
Sequence length 157
Comment Putative uncharacterized protein [Staphylococcus aureus subsp. aureus ST228]
Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGL
CIPELDGKMSYMIAVTGDNSADIAKYDIITLASSKYMVFEAQGAVPKAVQQKMEEVHHYI
HQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG
Download sequence
Identical sequences gi|470225471|ref|YP_007624050.1| gi|470199915|ref|YP_007586315.1| gi|470223504|ref|YP_007622061.1| gi|470197945|ref|YP_007584346.1| WP_015445934.1.13062 WP_015445934.1.13405 WP_015445934.1.17046 WP_015445934.1.25772 WP_015445934.1.28848 WP_015445934.1.31468 WP_015445934.1.33416 WP_015445934.1.35285 WP_015445934.1.36176 WP_015445934.1.37606 WP_015445934.1.40406 WP_015445934.1.42198 WP_015445934.1.43618 WP_015445934.1.47439 WP_015445934.1.4950 WP_015445934.1.50555 WP_015445934.1.54253 WP_015445934.1.57047 WP_015445934.1.60360 WP_015445934.1.63678 WP_015445934.1.71257 WP_015445934.1.74237 WP_015445934.1.75044 WP_015445934.1.78091 WP_015445934.1.91177 WP_015445934.1.94797 WP_015445934.1.98054 WP_015445934.1.98978 gi|470192050|ref|YP_007578360.1| gi|470194015|ref|YP_007580368.1| gi|470195981|ref|YP_007582333.1| gi|470219682|ref|YP_007620076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]