SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16077139|ref|NP_387952.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16077139|ref|NP_387952.1|
Domain Number 1 Region: 1-239
Classification Level Classification E-value
Superfamily Hsp33 domain 9.29e-79
Family Hsp33 domain 0.00000000135
Further Details:      
 
Domain Number 2 Region: 229-287
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 3.92e-22
Family HSP33 redox switch-like 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16077139|ref|NP_387952.1|
Sequence length 291
Comment 33 kDa chaperonin [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGDD
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGTNGTLSVVK
DLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLM
PGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKE
RFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR
Download sequence
Identical sequences A0A063X9K8 A0A0T8Q139 A0A125UD46 A0A199W9L2 A0A1X7FP80 A0A1Y0WSS4 A0A285L6T0 D4G3F8 G4ENT2 L8ABZ5 P37565 U1ZC99
gi|430756375|ref|YP_007211188.1| NP_387952.1.22788 WP_003226695.1.100042 WP_003226695.1.101301 WP_003226695.1.11088 WP_003226695.1.11231 WP_003226695.1.11257 WP_003226695.1.1140 WP_003226695.1.11581 WP_003226695.1.12759 WP_003226695.1.1358 WP_003226695.1.14761 WP_003226695.1.15902 WP_003226695.1.16291 WP_003226695.1.18944 WP_003226695.1.19261 WP_003226695.1.20099 WP_003226695.1.20502 WP_003226695.1.21045 WP_003226695.1.23108 WP_003226695.1.2546 WP_003226695.1.25531 WP_003226695.1.27372 WP_003226695.1.27612 WP_003226695.1.27660 WP_003226695.1.2914 WP_003226695.1.31028 WP_003226695.1.31100 WP_003226695.1.31786 WP_003226695.1.32025 WP_003226695.1.32219 WP_003226695.1.32420 WP_003226695.1.32693 WP_003226695.1.33285 WP_003226695.1.33846 WP_003226695.1.34621 WP_003226695.1.35833 WP_003226695.1.36189 WP_003226695.1.39562 WP_003226695.1.39605 WP_003226695.1.40859 WP_003226695.1.42762 WP_003226695.1.43852 WP_003226695.1.44140 WP_003226695.1.44184 WP_003226695.1.45019 WP_003226695.1.47157 WP_003226695.1.47672 WP_003226695.1.51783 WP_003226695.1.5262 WP_003226695.1.52847 WP_003226695.1.52860 WP_003226695.1.54948 WP_003226695.1.55792 WP_003226695.1.56274 WP_003226695.1.56411 WP_003226695.1.57156 WP_003226695.1.57184 WP_003226695.1.57201 WP_003226695.1.5726 WP_003226695.1.57513 WP_003226695.1.6139 WP_003226695.1.63795 WP_003226695.1.64889 WP_003226695.1.6517 WP_003226695.1.65188 WP_003226695.1.65223 WP_003226695.1.67028 WP_003226695.1.71402 WP_003226695.1.7186 WP_003226695.1.71916 WP_003226695.1.72516 WP_003226695.1.72999 WP_003226695.1.76814 WP_003226695.1.76977 WP_003226695.1.78686 WP_003226695.1.78811 WP_003226695.1.79046 WP_003226695.1.79288 WP_003226695.1.79712 WP_003226695.1.79987 WP_003226695.1.80832 WP_003226695.1.81116 WP_003226695.1.81747 WP_003226695.1.82722 WP_003226695.1.84183 WP_003226695.1.84434 WP_003226695.1.84556 WP_003226695.1.88042 WP_003226695.1.88382 WP_003226695.1.88591 WP_003226695.1.89000 WP_003226695.1.89821 WP_003226695.1.90830 WP_003226695.1.91060 WP_003226695.1.9164 WP_003226695.1.91723 WP_003226695.1.92915 WP_003226695.1.93073 WP_003226695.1.93420 WP_003226695.1.94199 WP_003226695.1.95009 WP_003226695.1.95211 WP_003226695.1.96043 WP_003226695.1.97264 WP_003226695.1.979 WP_003226695.1.99399 224308.BSU00710 APC1014 gi|402774314|ref|YP_006628258.1| gi|321313741|ref|YP_004206028.1| gi|384173730|ref|YP_005555115.1| gi|16077139|ref|NP_387952.1| gi|428277486|ref|YP_005559221.1| gi|470160222|ref|YP_007531997.1| gi|560127095|ref|YP_008828236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]