SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16077278|ref|NP_388091.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16077278|ref|NP_388091.1|
Domain Number 1 Region: 47-260
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.38e-35
Family beta-Lactamase/D-ala carboxypeptidase 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16077278|ref|NP_388091.1|
Sequence length 267
Comment beta-lactamase YbxI [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKDTDGTFILHDLQKDQT
FVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGVKREFESWNRDHTLGSA
MRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFWLQSSLTISPLEQETFLE
KLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVF
VTNVDDSGTKAKNITVDILKKYGLITS
Download sequence
Identical sequences A0A164W6S7 A0A1D8FGJ6 A0A1X7FPE7 A0A285L5M1 L8ABC7 P54427
224308.BSU02090 gi|560127234|ref|YP_008828375.1| gi|470160359|ref|YP_007532134.1| NP_388091.1.22788 WP_003246349.1.11257 WP_003246349.1.1140 WP_003246349.1.12759 WP_003246349.1.15902 WP_003246349.1.16291 WP_003246349.1.27660 WP_003246349.1.2914 WP_003246349.1.32219 WP_003246349.1.32420 WP_003246349.1.33846 WP_003246349.1.36189 WP_003246349.1.39605 WP_003246349.1.40859 WP_003246349.1.43852 WP_003246349.1.44184 WP_003246349.1.45019 WP_003246349.1.47157 WP_003246349.1.56274 WP_003246349.1.56411 WP_003246349.1.57201 WP_003246349.1.5726 WP_003246349.1.57513 WP_003246349.1.6139 WP_003246349.1.6517 WP_003246349.1.65223 WP_003246349.1.72999 WP_003246349.1.76977 WP_003246349.1.78686 WP_003246349.1.79046 WP_003246349.1.81116 WP_003246349.1.81747 WP_003246349.1.82722 WP_003246349.1.88042 WP_003246349.1.91723 WP_003246349.1.93420 WP_003246349.1.94199 WP_003246349.1.96043 WP_003246349.1.979 gi|16077278|ref|NP_388091.1| gi|402774449|ref|YP_006628393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]