SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16077312|ref|NP_388125.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16077312|ref|NP_388125.1|
Domain Number 1 Region: 18-327
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.99e-154
Family Glutaminase 0.0000000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16077312|ref|NP_388125.1|
Sequence length 327
Comment glutaminase 1 [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVNDSQLGICVLEPDGTM
IHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEPTGDAFNSIIRLEINKPGKP
FNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIHEEVFRSEWETAHRNRAL
AYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILAHDGYHPIRHEQVIPKDVA
KLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPPSARREQPFQSGCGIGIYGP
AIDEYGNSLTGGMLLKHMAQEWELSIF
Download sequence
Identical sequences A0A164W5Q4 A0A1B2B984 G4F0F9 L8AAW4 O31465
gi|560127270|ref|YP_008828411.1| d1mkia1 d1mkib1 d2osua2 d2osub2 gi|321313911|ref|YP_004206198.1| gi|470160393|ref|YP_007532168.1| gi|16077312|ref|NP_388125.1| 224308.BSU02430 APC1040 SR79 NP_388125.1.22788 WP_003234829.1.11257 WP_003234829.1.1140 WP_003234829.1.12759 WP_003234829.1.15902 WP_003234829.1.16291 WP_003234829.1.18944 WP_003234829.1.20099 WP_003234829.1.2914 WP_003234829.1.32219 WP_003234829.1.32420 WP_003234829.1.33846 WP_003234829.1.36189 WP_003234829.1.39605 WP_003234829.1.40859 WP_003234829.1.44184 WP_003234829.1.45019 WP_003234829.1.47157 WP_003234829.1.56274 WP_003234829.1.56411 WP_003234829.1.57184 WP_003234829.1.57201 WP_003234829.1.5726 WP_003234829.1.57513 WP_003234829.1.6139 WP_003234829.1.6517 WP_003234829.1.65188 WP_003234829.1.65223 WP_003234829.1.72999 WP_003234829.1.74782 WP_003234829.1.76977 WP_003234829.1.78686 WP_003234829.1.79987 WP_003234829.1.81116 WP_003234829.1.81747 WP_003234829.1.82722 WP_003234829.1.88042 WP_003234829.1.91723 WP_003234829.1.93073 WP_003234829.1.93420 WP_003234829.1.94199 WP_003234829.1.96043 WP_003234829.1.97264 WP_003234829.1.979 3agf_A 3agf_B gi|402774483|ref|YP_006628427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]