SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16077399|ref|NP_388212.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16077399|ref|NP_388212.1|
Domain Number 1 Region: 627-794
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.4e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 4-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.81e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0017
Further Details:      
 
Domain Number 3 Region: 143-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0037
Further Details:      
 
Domain Number 4 Region: 513-635
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.45e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16077399|ref|NP_388212.1|
Sequence length 805
Comment nitrite reductase [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNRILLSKVLQGDTDIKD
ITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDELILATGSVPFILPIPG
ADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARGLLNLGMDVSVIHLAPFL
MERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGLRFKDGTSIEADLVVMAVG
IRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHMCGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPLSQEAGTSITAAMSDDEIICGC
NGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKPLVEEILQHTLGSDFDASAQKEA
ICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPEGCSKCRPALNYYLGMINPTKYED
DRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQSVLNDPEKRQELNGRMNETLSVH
KDPWKDFLEDKQTSKELFENVVTTS
Download sequence
Identical sequences A0A0T8PUH4 A0A162RBG1 A0A1B2B1I4 G4F069 L8AC98 P42435
APC62037.0 gi|560127362|ref|YP_008828503.1| gi|470160480|ref|YP_007532255.1| 224308.BSU03300 gi|402774570|ref|YP_006628514.1| NP_388212.1.22788 WP_003234637.1.11257 WP_003234637.1.1140 WP_003234637.1.12644 WP_003234637.1.12759 WP_003234637.1.15902 WP_003234637.1.16291 WP_003234637.1.27372 WP_003234637.1.2914 WP_003234637.1.32219 WP_003234637.1.32420 WP_003234637.1.33846 WP_003234637.1.36189 WP_003234637.1.39605 WP_003234637.1.40859 WP_003234637.1.44140 WP_003234637.1.44184 WP_003234637.1.45019 WP_003234637.1.47157 WP_003234637.1.56274 WP_003234637.1.56411 WP_003234637.1.57184 WP_003234637.1.57201 WP_003234637.1.5726 WP_003234637.1.57513 WP_003234637.1.6139 WP_003234637.1.6517 WP_003234637.1.65223 WP_003234637.1.69439 WP_003234637.1.7159 WP_003234637.1.72999 WP_003234637.1.76977 WP_003234637.1.78686 WP_003234637.1.80832 WP_003234637.1.81116 WP_003234637.1.81747 WP_003234637.1.82722 WP_003234637.1.87300 WP_003234637.1.88042 WP_003234637.1.91723 WP_003234637.1.93420 WP_003234637.1.94199 WP_003234637.1.96043 WP_003234637.1.979 gi|16077399|ref|NP_388212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]