SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16077564|ref|NP_388378.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16077564|ref|NP_388378.1|
Domain Number 1 Region: 209-328
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.14e-39
Family NlpC/P60 0.00051
Further Details:      
 
Domain Number 2 Region: 59-192
Classification Level Classification E-value
Superfamily Lysozyme-like 0.00000000000000242
Family Bacterial muramidase, catalytic domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16077564|ref|NP_388378.1|
Sequence length 329
Comment endopeptidase YddH [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MISKKVVLPLVFSAPFIFFFVLCIVVVMTISRENQVGDDFIGGGDGEYETVGIAPEVERF
RAVFEKYARQEGVFDQVNIIMALTMQESGGRSLDIMQSSESIGLPPNSITDPERSIEVGI
KHFKKVFKQAGGDVRLTLQAYNFGSGFIDYVKKNGGKYTKKLALDFSRLQAFKMGWKSYG
DPSYVDHVMRYVKGSDKNVKPVKGSMDFYETVMKEALKYEGQPYAWGGSNPETGFDCSGL
VQWSFAKAGITLPRTAQEQHGATKKISEKEATAGDLVFFGGTYEGKAITHVGIYVGNGRM
FNSNDSGIQYSDLKSGYWRDHLVSFGRIK
Download sequence
Identical sequences A0A1D8FH95 P96645
224308.BSU04970 gi|470160654|ref|YP_007532429.1| gi|16077564|ref|NP_388378.1| NP_388378.1.22788 WP_009966633.1.11257 WP_009966633.1.1140 WP_009966633.1.2914 WP_009966633.1.32420 WP_009966633.1.33846 WP_009966633.1.36189 WP_009966633.1.40859 WP_009966633.1.45019 WP_009966633.1.47157 WP_009966633.1.56411 WP_009966633.1.57201 WP_009966633.1.5726 WP_009966633.1.57513 WP_009966633.1.6517 WP_009966633.1.65223 WP_009966633.1.72999 WP_009966633.1.76977 WP_009966633.1.81116 WP_009966633.1.91723 WP_009966633.1.93420 WP_009966633.1.94199 WP_009966633.1.96043 WP_009966633.1.979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]