SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16078222|ref|NP_389039.1| from Bacillus subtilis subsp. subtilis str. 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16078222|ref|NP_389039.1|
Domain Number 1 Region: 46-179
Classification Level Classification E-value
Superfamily Lysozyme-like 1.24e-49
Family Bacterial muramidase, catalytic domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16078222|ref|NP_389039.1|
Sequence length 181
Comment murein lytic transglycosylase YjbJ [Bacillus subtilis subsp. subtilis str. 168]
Sequence
MLNSANTTAPSLLSAYGLNSYTSSNSGSVTKAAESTETAVADSASNKHEANQIRSGDFSI
DSAIKKAADKYGVDEKLIRAVIKQESGFNAKAVSGAGAMGLMQLMPSTASSLGVSNPLDP
QQNVEGGTKYLKQMLDKYDGNVSMALAAYNAGPGNVDRYGGIPPFQETQNYVKKITSVYY
A
Download sequence
Identical sequences A0A0A1HAW6 O31608
gi|402775381|ref|YP_006629325.1| gi|16078222|ref|NP_389039.1| gi|470161317|ref|YP_007533092.1| NP_389039.1.22788 WP_010886480.1.11257 WP_010886480.1.1140 WP_010886480.1.12759 WP_010886480.1.15902 WP_010886480.1.16291 WP_010886480.1.19261 WP_010886480.1.27372 WP_010886480.1.27660 WP_010886480.1.2914 WP_010886480.1.32219 WP_010886480.1.32420 WP_010886480.1.33846 WP_010886480.1.36189 WP_010886480.1.39605 WP_010886480.1.40859 WP_010886480.1.44140 WP_010886480.1.44184 WP_010886480.1.45019 WP_010886480.1.47157 WP_010886480.1.56274 WP_010886480.1.56411 WP_010886480.1.5726 WP_010886480.1.57513 WP_010886480.1.6139 WP_010886480.1.6517 WP_010886480.1.65223 WP_010886480.1.72999 WP_010886480.1.76977 WP_010886480.1.78686 WP_010886480.1.78811 WP_010886480.1.79712 WP_010886480.1.81116 WP_010886480.1.81747 WP_010886480.1.82722 WP_010886480.1.88042 WP_010886480.1.91723 WP_010886480.1.93420 WP_010886480.1.94199 WP_010886480.1.96043 WP_010886480.1.979 224308.BSU11570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]